Protein Info for Psyr_3953 in Pseudomonas syringae pv. syringae B728a

Annotation: signal peptidase I, Serine peptidase, MEROPS family S26A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details PF10502: Peptidase_S26" amino acids 60 to 263 (204 residues), 181.6 bits, see alignment E=6.1e-58 TIGR02227: signal peptidase I" amino acids 64 to 266 (203 residues), 162.1 bits, see alignment E=5.2e-52

Best Hits

Swiss-Prot: 86% identical to LEP_PSEFL: Signal peptidase I (lepB) from Pseudomonas fluorescens

KEGG orthology group: K03100, signal peptidase I [EC: 3.4.21.89] (inferred from 99% identity to psp:PSPPH_3950)

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPD9 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Psyr_3953 signal peptidase I, Serine peptidase, MEROPS family S26A (Pseudomonas syringae pv. syringae B728a)
MSLNFPLLLVIAVFVCGVLALIDLVILAPRRRAAISNYQGSVGEPDIAVVERLNKEPLLV
EYGKSFFPVLFIVLVLRSFLVEPFQIPSGSMKPTLDVGDFILVNKFAYGIRLPVLDQKVI
QIGDPQRGDVMVFRYPSDPSVNYIKRVVGLPGDRIRYTSDKRLFINGELVAKKLIGTEPG
TLGSAELYEEQLGEVEHQIRQEMSRYRAPPDSEWTVPAAHYFMMGDNRDNSNDSRYWDDP
NIPKDELGMVPDKNIVGKAFAVWMSWPEPKLSHFPNFARVGLIK