Protein Info for Psyr_3946 in Pseudomonas syringae pv. syringae B728a

Annotation: Proteobacterial methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR00740: tRNA (cmo5U34)-methyltransferase" amino acids 6 to 246 (241 residues), 290.7 bits, see alignment E=4.8e-91 PF00891: Methyltransf_2" amino acids 52 to 190 (139 residues), 30.2 bits, see alignment E=7e-11 PF13847: Methyltransf_31" amino acids 57 to 169 (113 residues), 28.8 bits, see alignment E=2.4e-10 PF08242: Methyltransf_12" amino acids 63 to 165 (103 residues), 35.8 bits, see alignment E=2.9e-12 PF13649: Methyltransf_25" amino acids 63 to 163 (101 residues), 44 bits, see alignment E=7.7e-15 PF08241: Methyltransf_11" amino acids 63 to 167 (105 residues), 37.5 bits, see alignment E=7.8e-13

Best Hits

Swiss-Prot: 100% identical to CMOA_PSEU2: Carboxy-S-adenosyl-L-methionine synthase (cmoA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K15256, tRNA (cmo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to psb:Psyr_3946)

MetaCyc: 54% identical to carboxy-S-adenosyl-L-methionine synthase (Escherichia coli K-12 substr. MG1655)
RXN0-7066

Predicted SEED Role

"tRNA (uridine-5-oxyacetic acid methyl ester) 34 synthase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPE6 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Psyr_3946 Proteobacterial methyltransferase (Pseudomonas syringae pv. syringae B728a)
MSKETDRIFAQPLSQVPDFAFNEDVVRVFPDMIKRSVPGYPTIVENLGVLAAQFAQPNTV
LYDLGSSLGAVTQALRRHVRGEGCEVIAIDNSSAMVERCREYLNAQDSMFQELLPVQVLE
GDILALAFKPASVVALNFTLQFIAPEQRLALLGRIRDALVPGGALILSEKLRFDDPQEQA
LLTDLHIAFKRANGYSDLEIAQKRSAIENVMKPDSLEEHRQRLLAAGFSKVVPWFQCLNF
TSLIALP