Protein Info for Psyr_3942 in Pseudomonas syringae pv. syringae B728a

Annotation: diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 784 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 279 to 298 (20 residues), see Phobius details PF14827: dCache_3" amino acids 41 to 204 (164 residues), 51 bits, see alignment E=3e-17 PF00672: HAMP" amino acids 297 to 345 (49 residues), 51.6 bits, see alignment 1.9e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 353 to 495 (143 residues), 62.3 bits, see alignment E=2.3e-21 PF00990: GGDEF" amino acids 357 to 498 (142 residues), 86.3 bits, see alignment E=4.1e-28 PF00563: EAL" amino acids 528 to 762 (235 residues), 245.4 bits, see alignment E=1.1e-76

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3942)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPF0 at UniProt or InterPro

Protein Sequence (784 amino acids)

>Psyr_3942 diguanylate cyclase/phosphodiesterase (Pseudomonas syringae pv. syringae B728a)
MKFKASFQARIAGVLIVLLLIVVSAVYLAVKVATGDAVRTQAQAQLEVGSRVFERLIDLR
GKRLRDTVQLVAADFGFRDAVASADSSTIRSVLLNHGKRINASDMFLLGMDGVVIASTVP
KVPEGSRFVYDQALRNAKRAGQSVLIVPGGGDPHLLVEATVLAPLPIGRVVMGFTIDSDI
AEELRSLSGLEVSFLTVEDGKTGDLISTQPAALHAGLIELMRSSSEGQMLLTEQSNLNFL
SQTLMLANTSNGGDGQVIALLQSPLDKAYQAFAPLNQKIFWISMAALVASLIGTLALARS
VSLPVRALATAAKRIGDGDYKTPVALVRSDELGMLADAINTMQQGIAVREGQLAHNALHD
NLTGLPNRALVMERLGSSIAAHRGVALLSLSIENLATISESVSAEGVDQLLRQAGQRLQG
NLRAGDTVARLGANEFLLLLDNIASDGAVGMADAVQRLLSEPQRIDNHELELECCIGITV
YPEHGDSAQELLSRAAIARKDATFLPGRLQIYQDGRDLAHQRQITLIRDLRKAAQNGELS
LHYQPKLDIRQGYVRQAEALLRWAHPQFGSVSPAEFIVLAERTGSIYLLTNWVIEEAMRQ
LAVWRQRGLVLQVSVNISADDLLGDDLVGYVVKLLKQYAVPAEQLLFEITESAVMSEPEK
ALIVLHRLRDCGISLSIDDFGTGYSSLAHLKRLPVQELKIDQSFVRNLDETSEDAVIVRS
TIEMSHNLGLKVVAEGVEYQHSLDLLRRWHCDTAQGYLISRPLTASAFEAWIATYQASPG
LMVN