Protein Info for Psyr_3937 in Pseudomonas syringae pv. syringae B728a

Annotation: Polysaccharide deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF01522: Polysacc_deac_1" amino acids 43 to 145 (103 residues), 68.6 bits, see alignment E=5.1e-23 PF10096: DUF2334" amino acids 68 to 145 (78 residues), 27 bits, see alignment E=3.4e-10

Best Hits

Swiss-Prot: 77% identical to PGDAE_HELPG: Peptidoglycan deacetylase (pgdA) from Helicobacter pylori (strain G27)

KEGG orthology group: None (inferred from 99% identity to pst:PSPTO_4203)

Predicted SEED Role

"Putative polysaccharide deacetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPF5 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Psyr_3937 Polysaccharide deacetylase (Pseudomonas syringae pv. syringae B728a)
MAKEILCAFGVDVDAVAGWLGSYGGEDSPDDISRGLFAGEVGAPRLLKLFERYGLRTTWF
IPGHSMETFPEQMKAVADAGHEIGVHGYSHENPIAMTPEQEEIVLDKSIDLITQMTGKRP
TGYVAPWWEFSNVTNELLLKKGIKYDHSLMHNDFHPYYVRVGDKWTKIDYSQHPDTWMKP
LVRGEETDLVEIPANWYLDDLPPMMFIKKAPNSHGFVNPRHLEEMWRDQFDWVYREHEHA
VFTMTIHPDVSGRPQVLLMLERLIEHIQSHAGVKFVTFDEIADDFVRRNPRTR