Protein Info for Psyr_3934 in Pseudomonas syringae pv. syringae B728a

Annotation: Short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00106: adh_short" amino acids 7 to 197 (191 residues), 195.7 bits, see alignment E=8.7e-62 PF08659: KR" amino acids 10 to 161 (152 residues), 43.8 bits, see alignment E=4.2e-15 PF13561: adh_short_C2" amino acids 13 to 230 (218 residues), 186.3 bits, see alignment E=1.1e-58

Best Hits

Swiss-Prot: 40% identical to FABG_THEMA: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3934)

MetaCyc: 35% identical to 2-dehydro-3-deoxy-L-pentonate 4-dehydrogenase (Herbaspirillum huttiense)
RXN-12095 [EC: 1.1.1.401]; 1.1.1.401 [EC: 1.1.1.401]

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.401

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPF8 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Psyr_3934 Short-chain dehydrogenase/reductase SDR (Pseudomonas syringae pv. syringae B728a)
MQQLKQKRAVITGAGSGIGAAIARAYAAEGARLVLGDRDADSLAKIAAECRQLGAQVQEC
VADVGSVDGAQASVDACVEQFGGIDILVNNAGMLTQARCVDLTLDMWNDMLRIDLTSVFV
ASQRALPHMIAQRWGRIINVASQLGIKGGAELTHYAAAKAGVIGFSKSLALEVAKDNVLV
NAIAPGPIETPLVAGISSAWKTAKAAELPLGRFGLAEEVAPVAVLLASEPGGNLFVGQTL
GPNSGDVMP