Protein Info for Psyr_3919 in Pseudomonas syringae pv. syringae B728a

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01820: Dala_Dala_lig_N
  • amino acids 5 to 129 (125 residues), 118.7 bits, E=4.4e-38
• TIGR01205: D-alanine--D-alanine ligase
  • amino acids 5 to 347 (343 residues), 352.7 bits, E=7.9e-110
• PF02786: CPSase_L_D2
  • amino acids 139 to 315 (177 residues), 26.6 bits, E=8.5e-10
• PF02222: ATP-grasp
  • amino acids 146 to 314 (169 residues), 45.9 bits, E=1.1e-15
• PF07478: Dala_Dala_lig_C
  • amino acids 146 to 344 (199 residues), 238.1 bits, E=1.4e-74

Best Hits

Swiss-Prot: 93% identical to DDLA_PSESM: D-alanine--D-alanine ligase A (ddlA) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 100% identity to psb:Psyr_3919)

MetaCyc: 59% identical to D-alanine--D-alanine ligase A (Escherichia coli K-12 substr. MG1655)
D-alanine--D-alanine ligase. [EC: 6.3.2.4]

Predicted SEED Role

No annotation

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Alanine metabolism
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.4

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

See Q4ZPH3 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Psyr_3919 D-alanine--D-alanine ligase (Pseudomonas syringae pv. syringae B728a)
MKKSVAIVFGGQSSEHEVSLQSARNVINAIDRERYALTLIGVDKLGRWLHFDEADYLLNA
TDPARIKLSASGKPLSLLPGSIGGQFVDVESGQPLAAIDVVFPLIHGAFGEDGALQGLLR
MLSVPFVGADVLSSAACMDKDVTKRLLRDAGIAVAPFRVLSRGESLSFTEAADQLGLPMF
VKPANQGSSVGVSKVSDEAGFAAALALGFEFDHKLLIEQGIVGREVECAVLGNFDAQVSV
CGEVIANDEFYAYDTKYLNGDQARIAIPAELPADLSDQVRDVALQAYKVLGCAGLSRVDF
FVTEGRDIIINEVNTLPGFTSISMYPKLWQASGLSYAELIHRLIVLALERADQARLLKTE
IFP