Protein Info for Psyr_3904 in Pseudomonas syringae pv. syringae B728a

Annotation: Major intrinsic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 80% identical to GLPF_PSEAE: Glycerol uptake facilitator protein (glpF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02440, glycerol uptake facilitator protein (inferred from 100% identity to psb:Psyr_3904)

MetaCyc: 72% identical to glycerol facilitator (Escherichia coli K-12 substr. MG1655)
RXN0-7189; RXN0-7191; TRANS-RXN-131; TRANS-RXN0-460; TRANS-RXN0-536; TRANS-RXN0-537; TRANS-RXN0-551

Predicted SEED Role

"Glycerol uptake facilitator protein" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerol fermenation to 1,3-propanediol

MetaCyc Pathways

glycerol and glycerophosphodiester degradation (4/4 steps found)
glycerol degradation I (3/3 steps found)
arsenate detoxification III (2/2 steps found)
arsenic detoxification (plants) (4/6 steps found)
arsenic detoxification (yeast) (4/12 steps found)
arsenic detoxification (mammals) (7/17 steps found)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPI8 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Psyr_3904 Major intrinsic protein (Pseudomonas syringae pv. syringae B728a)
MSIALKQPTLTGQCVAEFLGTALMIFFGTGCVAALKVAGATFGLWEISIIWGIAVSMGIY
LSAGISGAHLNPAVSIALSLFAGFEKRKLPFYISAQIAGAFCGAGLVYLLYISLFFDFEH
AHHIIRGSEQSLELASVFSTYPNPAISVGQAFLVEVVITTILMGVIMALGDDSNGLPRGP
LAPLLIGLLVAVIGSSMGPLTGFAMNPARDFGPKLMTFFAGWGEMAFTGGRDIPYFLVPI
FAPILGACLGAAGYRALIARHLPSAAPVENEKEAPVVRGKVQASS