Protein Info for Psyr_3884 in Pseudomonas syringae pv. syringae B728a

Annotation: cold-shock DNA-binding protein family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 69 PF00313: CSD" amino acids 6 to 68 (63 residues), 101.8 bits, see alignment E=7.5e-34

Best Hits

Swiss-Prot: 100% identical to CAPB_PSEFR: Cold shock protein CapB (capB) from Pseudomonas fragi

KEGG orthology group: K03704, cold shock protein (beta-ribbon, CspA family) (inferred from 96% identity to psa:PST_1264)

Predicted SEED Role

"Cold shock protein CspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPK8 at UniProt or InterPro

Protein Sequence (69 amino acids)

>Psyr_3884 cold-shock DNA-binding protein family (Pseudomonas syringae pv. syringae B728a)
MSNRQTGTVKWFNDEKGFGFITPQSGDDLFVHFKAIQSDGFKSLKEGQQVSFIATRGQKG
MQAEEVQVI