Protein Info for Psyr_3880 in Pseudomonas syringae pv. syringae B728a

Annotation: Helicase, C-terminal:DEAD/DEAH box helicase, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 830 TIGR04121: DEXH box helicase, DNA ligase-associated" amino acids 9 to 821 (813 residues), 1137.9 bits, see alignment E=0 PF00270: DEAD" amino acids 22 to 203 (182 residues), 90.5 bits, see alignment E=2.7e-29 PF04851: ResIII" amino acids 24 to 200 (177 residues), 26.6 bits, see alignment E=1.3e-09 PF00271: Helicase_C" amino acids 250 to 358 (109 residues), 48.7 bits, see alignment E=2.1e-16 PF19306: WHD_Lhr" amino acids 385 to 554 (170 residues), 198.5 bits, see alignment E=1.4e-62 PF08494: DEAD_assoc" amino acids 606 to 792 (187 residues), 181.8 bits, see alignment E=3.3e-57

Best Hits

KEGG orthology group: K03724, ATP-dependent helicase Lhr and Lhr-like helicase [EC: 3.6.4.-] (inferred from 100% identity to psb:Psyr_3880)

Predicted SEED Role

"FIG003033: Helicase domain protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPL2 at UniProt or InterPro

Protein Sequence (830 amino acids)

>Psyr_3880 Helicase, C-terminal:DEAD/DEAH box helicase, N-terminal (Pseudomonas syringae pv. syringae B728a)
MSRPTDFARRWFLARGWKPFAFQKEVWAAVKNGESGLLHASTGSGKTYAVWFAALNRFAK
ANTLTADNKPRKRKPPAEPLSVLWITPMRALAADTARALEAPLAELDIPWSVGLRTGDTS
GSERARQSRRLPSALITTPESLTLLLTRADAQVALSTLKMVVVDEWHELIGNKRGVQLQL
ALARLRRWNPQLIVWGISATLGNQQHAQQVLIGDGGVTVQGKIVKDLQVDTLLPSSIERF
PWAGHMGLRMLPQVVAEVESSASCLVFTNTRAQSEIWYQALLEARPDWAGLIALHHGSLA
REVRDWVERALKEGALKAVVCTSSLDLGVDFLPVERVLQIGSPKGVARLMQRAGRSGHAP
GRPSRVTLVPTHSLELVEAAAAHDAVEARMIEPRESPHQPLDVLVQHLVSIALGGGFLPD
ELLGEVRSAWAYHDLSDEQWQWALAFVRNGGHSLTAYPDYRRAEPDEDGVWRVPDARLAR
RHRMSVGTIVSEATVNLKYWKKGGGGGSLGSVEEGFIARLKPGDGFLFGGRLLELVRVEN
MTAYVKRATGKKAAVPRWNGGRMPLSSELADAVVEKFDAAARGQFNSPEMRAIKPLLEVQ
QHWSGLPRRDTLLAETLKSREGWHLFLYPFAGRHVHLGLGSLLAWRLSRHRPLTFSIAVN
DYGLELLSASEIDWSQTLQAELFSETDLLPDIIASLNAGELALRRFREIARISGLVFSGY
PGAAKSNRQLQASSGLFFEVFKQYDADNMLLTQAEQEVLRQELDLQRLELTLRQINSRTL
DLHAIKRATPLAFPLLVERFRESLSSEKLADRIARMVRDLEKAAGPEPER