Protein Info for Psyr_3875 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid ABC transporter membrane protein 1, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 21 to 128 (108 residues), 68.8 bits, see alignment E=2.3e-23 PF00528: BPD_transp_1" amino acids 42 to 228 (187 residues), 88.9 bits, see alignment E=1.8e-29

Best Hits

Swiss-Prot: 59% identical to HISQ_SALTI: Histidine transport system permease protein HisQ (hisQ) from Salmonella typhi

KEGG orthology group: K10016, histidine transport system permease protein (inferred from 100% identity to psb:Psyr_3875)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPL7 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Psyr_3875 amino acid ABC transporter membrane protein 1, PAAT family (Pseudomonas syringae pv. syringae B728a)
MLDALMQNLGLSAFSLKGFGPLLLEGTWMTVKLAVLSLALSILLGLIGASAKLSSSALLR
VPAQIYTTLIRGVPDLVLMLLIFYSLQTWLTMLTDAMEWEYIEINPFGAGVITLGFIYGA
YFTETFRGAILSVPRGQVEAATAYGLKRGQRFRYVVFPQMMRYALPGIGNNWQVLLKATA
LVSIIGLADLVKASQDAGKSTYQLFYFLVLAALIYLLITSASNFALRWAERYYAAGSREA
QR