Protein Info for Psyr_3846 in Pseudomonas syringae pv. syringae B728a

Annotation: L-valine ABC transporter membrane protein / L-isoleucine ABC transporter membrane protein / L-leucine ABC transporter membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 242 to 269 (28 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 11 to 291 (281 residues), 176.8 bits, see alignment E=2.6e-56

Best Hits

Swiss-Prot: 81% identical to BRAD_PSEAE: High-affinity branched-chain amino acid transport system permease protein BraD (braD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 98% identity to pst:PSPTO_4109)

MetaCyc: 67% identical to branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPP6 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Psyr_3846 L-valine ABC transporter membrane protein / L-isoleucine ABC transporter membrane protein / L-leucine ABC transporter membrane protein (Pseudomonas syringae pv. syringae B728a)
MPELFHYMQQLVNGLTIGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVAFMALAGL
AMLGIHSLPLLMIAGFAAAIIVTSAYGYSIERVAYRPLRNSNRLIPLISAIGMSIFLQNS
VQLSQGSGNFAIPNLLPGSLSFGPGGAEEVLISYMQIVVFVVTLLAMTGLTLFISRSRMG
RACRACAEDMKMANLLGINTNNIIALTFVVGAALAAVAAMLLSMQYGVINPNAGFLVGLK
AFTAAVLGGIGSIPGAVLGGLVLGVAEAFGADIFGDQYKDVVAFGLLVLVLLFRPTGILG
RPEVEKV