Protein Info for Psyr_3845 in Pseudomonas syringae pv. syringae B728a

Annotation: L-leucine-binding protein / L-valine-binding protein / L-isoleucine-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 29 to 360 (332 residues), 216.2 bits, see alignment E=1.5e-67 PF13433: Peripla_BP_5" amino acids 30 to 349 (320 residues), 90.3 bits, see alignment E=2.2e-29 PF01094: ANF_receptor" amino acids 53 to 364 (312 residues), 106.9 bits, see alignment E=1.8e-34

Best Hits

Swiss-Prot: 69% identical to BRAC_PSEAE: Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein (braC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to psb:Psyr_3845)

MetaCyc: 58% identical to branched chain amino acid/phenylalanine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"High-affinity leucine-specific transport system, periplasmic binding protein LivK (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPP7 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Psyr_3845 L-leucine-binding protein / L-valine-binding protein / L-isoleucine-binding protein (Pseudomonas syringae pv. syringae B728a)
MTKGTNKLSRLFAALVMAGVASHSFAADTIKIGIAGPKTGPVAEYGTMQFNGARMAIEQI
NAKGGVDGKKLEAVEYDDACDPKQAVAVANKVVNDGVKYVVGHLCSSSAQPASDVYEDEG
IIMVTPAATSPEITARGYKLVFRTIGLDSAQGPAAGNYIADVAKPKIVAVIHDKQQYGEG
IATAVKQTLEKKGVKVALFEGINAGDKDFSSLIQKLKQANVDFVYYGGYHPELGQILRQS
KEKGLNAKFMGPEGVGNESISQIAGEASEGLLVTLPKSFDQDPANQALTEAFKAKSQDPS
GPFVYPSYSAVQVIADGIAAAKSEDTTKVAAAIHAGTFKTPMGELSYDEKGDLKNFQFVV
YEWHFGKPKTEAAK