Protein Info for Psyr_3775 in Pseudomonas syringae pv. syringae B728a

Annotation: Alpha/beta hydrolase fold protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00561: Abhydrolase_1" amino acids 18 to 250 (233 residues), 60.7 bits, see alignment E=3.7e-20 PF12697: Abhydrolase_6" amino acids 19 to 256 (238 residues), 63.8 bits, see alignment E=7.4e-21 PF12146: Hydrolase_4" amino acids 19 to 246 (228 residues), 44.3 bits, see alignment E=2.8e-15 PF08386: Abhydrolase_4" amino acids 204 to 269 (66 residues), 21.4 bits, see alignment E=4.5e-08

Best Hits

Swiss-Prot: 43% identical to RSBQ_BACSU: Sigma factor SigB regulation protein RsbQ (rsbQ) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3775)

Predicted SEED Role

"Hydrolase of unknown specificity RsbQ, part of a novel [RsbQ - PAS domain] bacterial sensing module"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPW6 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Psyr_3775 Alpha/beta hydrolase fold protein (Pseudomonas syringae pv. syringae B728a)
MSVQQRNNVNIMGDGPITLIFAHGFGCDQNMWRFIAPHFAERFKVVLFDLVGNGNSDVSA
WYPHKYSSLKGYATDLLEVVNEFAAEGPVVHVGHSVSCMIAVLAELQSPGRFDSHIMIGP
SPRYLNEEGYLGGFTRADVDSLLETLESNYLGWSSTIAPTLMGASDRPELSEELANSFCR
TNAEIARQFAHVTFLSDHRADVAQLKSRTLILQSSDDMVVPVEVGEYLHRVITDSTLHMI
DNVGHYPHMSAAQECITAMNQFLASCESAAHDR