Protein Info for Psyr_3752 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function UPF0060

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details PF02694: UPF0060" amino acids 4 to 106 (103 residues), 99.4 bits, see alignment E=6.8e-33

Best Hits

Swiss-Prot: 100% identical to Y3752_PSEU2: UPF0060 membrane protein Psyr_3752 (Psyr_3752) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K09771, hypothetical protein (inferred from 98% identity to psp:PSPPH_1503)

Predicted SEED Role

"Protein of unknown function UPF0060"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPY9 at UniProt or InterPro

Protein Sequence (110 amino acids)

>Psyr_3752 Protein of unknown function UPF0060 (Pseudomonas syringae pv. syringae B728a)
MLNYLWFFLAALFEIFGCYAFWLWLRQGKSALWVIPALVSLTVFALLLTRVEAAYAGRAY
AAYGGIYIVASIAWLGLVERVRPLGTDWLGLAFCVIGATIILLGPRWSAA