Protein Info for Psyr_3740 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF454

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 87 to 103 (17 residues), see Phobius details amino acids 108 to 125 (18 residues), see Phobius details PF04304: DUF454" amino acids 15 to 129 (115 residues), 151.3 bits, see alignment E=5.5e-49

Best Hits

Swiss-Prot: 45% identical to YBAN_ECOLI: Inner membrane protein YbaN (ybaN) from Escherichia coli (strain K12)

KEGG orthology group: K09790, hypothetical protein (inferred from 100% identity to psb:Psyr_3740)

Predicted SEED Role

"FIG039061: hypothetical protein related to heme utilization"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQ01 at UniProt or InterPro

Protein Sequence (137 amino acids)

>Psyr_3740 Protein of unknown function DUF454 (Pseudomonas syringae pv. syringae B728a)
MAQGSPRTSRHRSVRYLLVAIGWLSVVLGVIGIFLPVLPTTPFLLLAAACFARSSPRFYD
WLVNHPQLGPWIRDYLEGNGIPLKGKVYALGLMWLSISLSCYLVPSPWARVFMLTSAVLV
TLYILRQKTRAPGDRTR