Protein Info for Psyr_3738 in Pseudomonas syringae pv. syringae B728a

Annotation: ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 709 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 6 to 596 (591 residues), 815 bits, see alignment E=3.6e-249 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 8 to 456 (449 residues), 506 bits, see alignment E=1e-155 PF00270: DEAD" amino acids 22 to 182 (161 residues), 82.8 bits, see alignment E=6.3e-27 PF00271: Helicase_C" amino acids 218 to 323 (106 residues), 68.1 bits, see alignment E=2e-22 PF16124: RecQ_Zn_bind" amino acids 335 to 396 (62 residues), 72.1 bits, see alignment 1.3e-23 PF09382: RQC" amino acids 401 to 510 (110 residues), 125.2 bits, see alignment E=3e-40 PF00570: HRDC" amino acids 533 to 596 (64 residues), 78.2 bits, see alignment E=9.5e-26

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 100% identity to psb:Psyr_3738)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQ03 at UniProt or InterPro

Protein Sequence (709 amino acids)

>Psyr_3738 ATP-dependent DNA helicase RecQ (Pseudomonas syringae pv. syringae B728a)
MLEQAQRVLKDIFGYDSFRGRQGAIIERVASGGDALVLMPTGGGKSLCFQVPGLLRDGLC
VVVSPLIALMDDQVATLDELGVSAAALNSTLSAEQQRDLANRIRLGEVKMLYLAPERLVQ
PRMLSFLQNLKIALFAIDEAHCVSQWGHDFRPEYLQLGQLAELFPEVPRIALTATADKRT
REEIVTRLHLQNAERFLSSFDRPNIFYRIVPKEQPRKQLLAFLSERRSDAGIVYCLSRKK
VDEVAVFLSDNGYPALPYHAGLPSETRAANQKRFLNEEGLIMVATIAFGMGIDKPNVRFV
AHMDLPKSLEAYYQETGRAGRDGLPADAWMAYGLQDVLMLKQMLQNSEGDERHKRLEQHK
LDAMLALCEETRCRRQTLLAYFDEDMPNPCGHCDNCVDGVQTWDATEPARQALSAIYRTG
QRYGVGHLVDVLLGKSNDKVESFGHQHLSVFGVGKARTESEWRSLFRQLVARGLADIDLE
GYGGLRLSETCRPLLRGEVSLELRQDLKPQTTSRSSSGSPASQLVRGEEREQWEALRALR
RKLAEEHGVPPYVIFPDSTLLEMLRSKPGSMAEMAKVSGVGARKLERYGEAFLEVLSGKA
EAPRVVADVRHELISLARAGMTPTQIAGQLQCSEKNVYTLLAEAIGKQQLSIEQALDLPE
DLLGEVQDAFLDGEGELPPVSAIAEQFAGRVPEGVLYCVRAALQSEFEV