Protein Info for Psyr_3736 in Pseudomonas syringae pv. syringae B728a

Annotation: Peptidoglycan-binding LysM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 737 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details transmembrane" amino acids 355 to 376 (22 residues), see Phobius details amino acids 525 to 545 (21 residues), see Phobius details PF25800: FimV_N" amino acids 39 to 144 (106 residues), 126 bits, see alignment E=1e-40 TIGR03504: FimV C-terminal domain" amino acids 694 to 736 (43 residues), 49.1 bits, see alignment 2.3e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3736)

Predicted SEED Role

"Tfp pilus assembly protein FimV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQ05 at UniProt or InterPro

Protein Sequence (737 amino acids)

>Psyr_3736 Peptidoglycan-binding LysM (Pseudomonas syringae pv. syringae B728a)
MLKSLLAAVEGAGRKAREAFGKGVLAVSLLTCSTLASALGLGEITLHSALNQPLDAEIQL
LETGGLSNEDVVARLASPEAFAKAGMERVFFLNDLRFTPVLRGDRGVIRVVSSKPVTEPY
LSFLVQLARPNGDLLHEYTLLLDPATSAQGLAATRSRNQQRSASSASESRMPVAPPAAVQ
GKHYTVASGDTLNGIASRLQGPGNKVSASQLADGIRSLNPQVFAAGAGSALKVGQDLLLP
DAAVLPTAAAPAASAAAPSPKPAELQRTAEQLSAAAIENQQLTQSLEALKAQTQELQEQM
SGKDKQIIALRSDLATAQSAATPVAPATTTPAPATPVAAPAAPAQPVAASGSDSFLSLPI
LLAAVLIVLLLVAFAYSKRRQQRKESAAPGVTPDDPLIKPAQAAMLPVFEVPAVAPQPVV
QSPTTPAPAKPSPAQRSAGSAPDALDGVSIYIAYGRFTEAMGILRSALETQPERDDIRIR
LLELLAEQGDGSGFVREEQAALEHGVDPQTIQDIRDRFPQLKAAEVAPLAAIVPAAALAA
SALSFEKSEPEPSRYLQPEPEPEPAAQLDESAAAALNPQPADEFQLNLDDLSMDADWDLV
DPFDSPPPRAKPAAAPAPVEVDPGFSSDLTQLPEVFELSDEQFLSDFSEPEVVEPVEVIV
PSAADGLSDDFLDSFMNDDADFDLLDLEEPPLSQINQAQVLIEDGDLESAREILQQIIDE
SDEEHQRMARELLASIS