Protein Info for Psyr_3715 in Pseudomonas syringae pv. syringae B728a

Annotation: ATP-binding region, ATPase-like:Histidine kinase, HAMP region:Histidine kinase A, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 232 to 254 (23 residues), see Phobius details amino acids 513 to 529 (17 residues), see Phobius details PF00672: HAMP" amino acids 252 to 303 (52 residues), 41.7 bits, see alignment 1.8e-14 PF00512: HisKA" amino acids 309 to 373 (65 residues), 51.2 bits, see alignment E=1.6e-17 PF02518: HATPase_c" amino acids 423 to 532 (110 residues), 88.1 bits, see alignment E=8.1e-29

Best Hits

KEGG orthology group: K07639, two-component system, OmpR family, sensor histidine kinase RstB [EC: 2.7.13.3] (inferred from 100% identity to psb:Psyr_3715)

Predicted SEED Role

"Sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQ25 at UniProt or InterPro

Protein Sequence (536 amino acids)

>Psyr_3715 ATP-binding region, ATPase-like:Histidine kinase, HAMP region:Histidine kinase A, N-terminal (Pseudomonas syringae pv. syringae B728a)
MNSIFLRIYGGVLCVLVLVALLGVLALHVLNQSRGEQYRERLAHGTFTIMADNLLPLDGI
ERRRALAVWERLLGIPLSLQTLEQAHLDSSALGQLARGKVVVEQIGPHAARVYRQLSDKE
PLLLTGEVQQITEQLARATIYLLIDELVRFPVDEQPARLQALRSDKGFGFDLHLLALDQA
DLDDDQRRRVYEGDTVMALGKGGDSIRVLAGIVDTNWVLEIGPLYQMNPYPLHWLLLIAL
MGLCLIGLVVYLLVRRLERRVLELEAAATQIAQGSLHSRVPTEGSDSVGRVAAAFNSMAE
HLQRSLMIQRELVRAVSHELRTPVARLRFGLEMVSDAATPEARRKYMRGMDSDIQDLDKL
VDEMLTYARLEQGAPTLNFQRVDLDALIDQVIAELAPLRADVRVSRGECLRAEEGEAAWV
EGEPRYLHRAVQNLVSNALRHADNEVRISYRLEAQQCRIDVDDDGPGVPEQAWDQIFTPF
MRIDDSRTRASGGHGLGLSIVRRIIHWHEGRALIGHSVSLGGACFSLTWPRTQVPR