Protein Info for Psyr_3671 in Pseudomonas syringae pv. syringae B728a

Annotation: Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 46 to 65 (20 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 304 to 326 (23 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 330 (314 residues), 110 bits, see alignment E=6.1e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3671)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQ69 at UniProt or InterPro

Protein Sequence (402 amino acids)

>Psyr_3671 Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MTSIWRTSGWVLLGSALILALSLGTRHGFGLFLAPMSAEFGWGREVFAFAIALQNLMWGL
AQPFAGALADRFGAAKVVFVGGVLYAAGLLCMSTADSSLSLSLSAGLLIGIGLSGTSFSV
ILGVVGRALPAEKRSMGMGIASAAGSFGQFAMLPGTLGLISWLGWSGALLVLGVMVALIL
PLVGMLKDTPSVSTGVELTLGEALREACSHSGFWLLALGFFVCGFQVVFIGVHLPAYLVD
QHLPAKVGTTVLALIGLFNIFGTYTAGWLGGRMSKPRLLTVLYLLRAVVIVLFLWIPLSQ
TTAYLFGVAMGLLWLSTVPLTNGTVATLFGVRNLSMLGGIVFLFHQLGAFLGGWLGGLVY
DRTGSYDLIWQVSILLSLLAAALNWPVRERPVERLQAQGSLA