Protein Info for Psyr_3638 in Pseudomonas syringae pv. syringae B728a

Annotation: UDP-glucose 4-epimerase, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05368: NmrA
  • amino acids 8 to 259 (252 residues), 32.4 bits, E=2.7e-11
• PF04321: RmlD_sub_bind
  • amino acids 8 to 228 (221 residues), 58.4 bits, E=2.6e-19
• PF02719: Polysacc_synt_2
  • amino acids 8 to 254 (247 residues), 37.5 bits, E=6.3e-13
• PF01370: Epimerase
  • amino acids 8 to 232 (225 residues), 122 bits, E=1.1e-38
• PF01073: 3Beta_HSD
  • amino acids 9 to 256 (248 residues), 70.2 bits, E=6.1e-23
• PF16363: GDP_Man_Dehyd
  • amino acids 10 to 314 (305 residues), 66 bits, E=1.7e-21
• PF13460: NAD_binding_10
  • amino acids 12 to 176 (165 residues), 65.8 bits, E=1.9e-21
• PF07993: NAD_binding_4
  • amino acids 59 to 187 (129 residues), 45.3 bits, E=2.6e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3638)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (2/2 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (2/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See Q4ZQA2 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Psyr_3638 UDP-glucose 4-epimerase, putative (Pseudomonas syringae pv. syringae B728a)
MSGDVALVAITGATGFVGSAVVRRLIERTGCSVRVAVRGAYVVSSPRIDVVSAQSLAPDN
QWASFVTGADVVIHCAARVHVLNETADAPDQEYFRANVTATLNLAEQAAAAGVKRFIFIS
SIKANGESTLAGAPFTASDPCTPLDAYGVSKHRAEEGLRELSARTGMQVVIIRPVLVYGP
GVKANFRSMMRWLDKGLPLPLGSIDNRRSLVAVDNLADLVTVCVDHPAAADQTFLVSDGD
DLSTSRLLREMGKALGKPARLLPVPASLLKAAAALLGKKAFSQRLCNSLQVDISKTCTML
DWHPPVSIEHAMQDTARYYLEHDKHD