Protein Info for Psyr_3633 in Pseudomonas syringae pv. syringae B728a

Annotation: threonine/serine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 343 to 360 (18 residues), see Phobius details amino acids 366 to 390 (25 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 34 to 331 (298 residues), 48 bits, see alignment E=5.3e-17

Best Hits

Swiss-Prot: 55% identical to SDAC_HAEIN: Serine transporter (sdaC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03837, serine transporter (inferred from 100% identity to psb:Psyr_3633)

Predicted SEED Role

"Serine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions or Threonine anaerobic catabolism gene cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQA7 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Psyr_3633 threonine/serine transporter (Pseudomonas syringae pv. syringae B728a)
MNDQANGVVERLDVAPESIASWNRNDTTWMLGLFGTAIGAGTLFLPINAGIGGFWPLMAL
ALLAFPMTFYAHRGLTRFVLSGREGADITDVVEEHFGKSAGAMITLLYFFAIFPILLIYS
VALTNTVGSFLEHQLHITPPPRAALAFVLIMGLLAVVRCGERFIVKAMSLMVYPFIVALL
FLAIFLIPHWTGGILSTATTFPELSAFIPTLWLAIPVMVFSFNHTPIISAFAVDQKRQYG
ENAEVRSSQILARAHGLMVVMVLFFVFSCVLTLSPAQLAEAKAQNISILSYLANHFNNPT
IAFVAPLIAFVAISKSFLGHYIGASEGLKGLVLKAGRRPAPKALDRMTAAFMLVVCWLVA
TLNPSILGMIETLGGPVISALLFLMPMYAIHKVPAMRKYAGAWSNYFVVAAGVVAISALI
FSLIR