Protein Info for Psyr_3606 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter, substrate-binding protein, aliphatic sulfonate

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 38 to 311 (274 residues), 199.7 bits, see alignment E=3e-63 PF13379: NMT1_2" amino acids 43 to 249 (207 residues), 47.4 bits, see alignment E=5.7e-16 PF04069: OpuAC" amino acids 46 to 267 (222 residues), 24.5 bits, see alignment E=4.8e-09 PF12974: Phosphonate-bd" amino acids 60 to 233 (174 residues), 53.1 bits, see alignment E=7.6e-18 PF09084: NMT1" amino acids 64 to 243 (180 residues), 71.3 bits, see alignment E=2.8e-23

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to psb:Psyr_3606)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQD4 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Psyr_3606 ABC transporter, substrate-binding protein, aliphatic sulfonate (Pseudomonas syringae pv. syringae B728a)
MPTTLVLWSQRLLKGLALSLVASLNTQAANLIVGDQSYSARTVMEAAGVLEDLPYELEWK
QFTAGSPVAEALNVGSLDIGLLGDSPALFMGALGAPIKVIGVSRQNLDGVAIVVRKDSPI
KTVADLAGKKVAIWKGSFSQQLMLTALDKAGVARDAVDYRYLSALDSSHALDGGSVDAIA
TWEPYVTQQERQGARIIATAEGLIPAQSFIVANDQAIKDKRAQISDFLQRLQAARAWSVS
DPQHNERYANAWSALTKADAEVARRWFSRAQVVVVPITAQVVAGAQQTIDFFNNAGLTKR
YPAASVFDESFSAALADQAQAVR