Protein Info for Psyr_3604 in Pseudomonas syringae pv. syringae B728a

Annotation: Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF02771: Acyl-CoA_dh_N" amino acids 9 to 95 (87 residues), 38.3 bits, see alignment E=3.2e-13 PF02770: Acyl-CoA_dh_M" amino acids 134 to 224 (91 residues), 49.1 bits, see alignment E=1e-16 PF00441: Acyl-CoA_dh_1" amino acids 254 to 368 (115 residues), 30.1 bits, see alignment E=1e-10 PF08028: Acyl-CoA_dh_2" amino acids 258 to 371 (114 residues), 40.1 bits, see alignment E=9e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3604)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQD6 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Psyr_3604 Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central region (Pseudomonas syringae pv. syringae B728a)
MKLSPLRQHRELSESAADFATRLEGITATLAETAEHYDASGAFPHANFALLHSHGLLGFT
VPAELGGGGADLARAQQVVSAVARGEPSTALILVMQYLQHSRLQENSQWPTDLRIRVAEE
AVRDGALINALRVEPDLGTPARGGLPGTIACRTAEGWRISGSKIYSTGSHGLTWFAVWAR
SDDDDPLVGSWLVHKDTPGITIIEDWDHLGMRATSSHEVRFDNVLVPLDHAVSVSPWSAP
QSELDGSGLLWMAVLLSSVYDGIAQSARDWLVHWLEQRTPSNLGASLSTLPRFQETVGQI
DTLLFANRTLLHSAAHGHTPAQHAGQIKYLVTGNAIRAVELAIEASGNPGLSRSNPLQRH
YRNVLCGRVHTPQNDAVLVNVGKAAFAARSKDQ