Protein Info for Psyr_3593 in Pseudomonas syringae pv. syringae B728a

Annotation: K+ transporter Trk

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 330 to 355 (26 residues), see Phobius details amino acids 395 to 416 (22 residues), see Phobius details amino acids 457 to 482 (26 residues), see Phobius details PF02386: TrkH" amino acids 43 to 478 (436 residues), 212.9 bits, see alignment E=3.5e-67 TIGR00933: potassium uptake protein, TrkH family" amino acids 88 to 467 (380 residues), 332.7 bits, see alignment E=1.7e-103

Best Hits

Swiss-Prot: 54% identical to TRKI_HALED: Trk system potassium uptake protein TrkI (trkI) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 100% identity to psb:Psyr_3593)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQE7 at UniProt or InterPro

Protein Sequence (484 amino acids)

>Psyr_3593 K+ transporter Trk (Pseudomonas syringae pv. syringae B728a)
MSLPTLRIIGFIIGIFLITLAVAMIVPMATLVIYDRFEDLREFLWASAITFIAGLALVVP
GRPDNVQLRPRDMYMLTVSSWIVVCIFAALPFLLTQHISYTDSFFESMSGITATGSTVLS
NLDSMSPGILIWRSMLHWLGGIGFIGMAVAILPLLRIGGMRLFQTESSDRSEKVMPRSHM
VAKFIVLAYVGFTALGSLAFWAAGMSLFDAINHAMSAISTGGFSTSDQSLAKWPQPAVHW
VAIVVMILGSLPFTLYVATLRGNRKALIKDEQVQGLIGLLLITWLVMTVWYANTTDLPWT
EALRHVALNVTSVVTTTGFALGDYSLWGNFSLMLFFYLGFIGGCSGSTAGGVKIFRFQVA
YILLKTNLNQLIHPRAVIKQKYNGHRLDDEIVRSILTFSFFFTITICLIALMLSLLGLDW
MTALTGAASTVSGVGPGLGEVIGPAGNFSTLPDAAKWILSGGMLLGRLEIITVLVLCVPA
FWRH