Protein Info for Psyr_3587 in Pseudomonas syringae pv. syringae B728a

Annotation: Intracellular septation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 107 to 123 (17 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details PF04279: IspA" amino acids 14 to 201 (188 residues), 209.6 bits, see alignment E=2.1e-66 TIGR00997: intracellular septation protein A" amino acids 14 to 201 (188 residues), 182.8 bits, see alignment E=3.3e-58

Best Hits

Swiss-Prot: 98% identical to YCIB_PSESM: Probable intracellular septation protein A (PSPTO_1809) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K06190, intracellular septation protein (inferred from 100% identity to psb:Psyr_3587)

Predicted SEED Role

"Intracellular septation protein IspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQF3 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Psyr_3587 Intracellular septation protein A (Pseudomonas syringae pv. syringae B728a)
MLLCRHILLLAAIVKQFIDFIPLLLFFIVYKTEPRAVDILGNTYMVGGIFSATAMLIISS
VVVYGILYVKQRKLEKSQWLTLVACLVFGSLTLAFHSETFLKWKAPVVNWLFAVAFAGSH
FIGDRPLIQRIMGHALTLPAAIWTRLNIAWIIFFLFCGAANLYVAFTYQEFWVDFKVFGS
LGMTLIFLVGQGIYLSRHLHDTTPNTPKSED