Protein Info for Psyr_3586 in Pseudomonas syringae pv. syringae B728a

Annotation: Phosphoesterase PHP, N-terminal:PHP, C-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02811: PHP
  • amino acids 4 to 67 (64 residues), 45.1 bits, E=7.1e-16

Best Hits

Swiss-Prot: 40% identical to RNAAM_ECOLI: 5'-3' exoribonuclease (yciV) from Escherichia coli (strain K12)

KEGG orthology group: K07053, (no description) (inferred from 100% identity to psb:Psyr_3586)

MetaCyc: 40% identical to RNase AM (Escherichia coli K-12 substr. MG1655)
RXN-16009 [EC: 3.1.3.97]; 3.1.13.- [EC: 3.1.3.97]; RXN-24047 [EC: 3.1.3.97]

Predicted SEED Role

"COG0613, Predicted metal-dependent phosphoesterases (PHP family)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.97

Sequence Analysis Tools

See Q4ZQF4 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Psyr_3586 Phosphoesterase PHP, N-terminal:PHP, C-terminal (Pseudomonas syringae pv. syringae B728a)
MNVDLHCHSTASDGALSPTALVARAHENGVRVLSLTDHDTLEGLEEARAAAHSLGMQLVN
GVELSCTWGGATIHILGYGFDTRAPALTEAISRLHEGRWLRAEEISRKLAIKGMPGALEG
ARAIQQELGDSGNAPARPHFADFMVRSGFVKDRAEAFRKWLGAGKLGDVKQHWPTLEDTV
ATLRASGAWVSLAHPSHYDFTRSKRRKLVGDFVQAGGHAIEVVNGMQPADQVGTLAILAR
EFGLLVSAGSDFHGPGTWGEIGTYRPVPEDLPPLWCRFKHEQPTASV