Protein Info for Psyr_3578 in Pseudomonas syringae pv. syringae B728a

Annotation: Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 220 to 246 (27 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details amino acids 307 to 330 (24 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details amino acids 369 to 391 (23 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 251 (228 residues), 55.4 bits, see alignment E=2.5e-19 amino acids 226 to 391 (166 residues), 49.3 bits, see alignment E=1.7e-17

Best Hits

Swiss-Prot: 73% identical to Y3873_PSEAB: Uncharacterized MFS-type transporter PA14_38730 (PA14_38730) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3578)

Predicted SEED Role

"Xanthine transporter,putative" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQG2 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Psyr_3578 Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MSETQQKTPQTPMAVTLTVVSIVMFTFIGYLNIGIPLAVLPGYVHSDLGFGAVIAGLVIS
VQYLATLISRPWSSRIIDNLGSKKAVQIGLTGCGLSGVFMLVPVWLDSWPMASLVILLIG
RVILGAAESLVGSGSIGWGIGRVGAQNTAKVISWNGIASYGALAIGAPLGVWMVDELGLW
TVGVSIMLLCALGLYLTWHKEPAPIVQGERLPFMHVLGRVFPHGMGLALGGIGFGTIATF
ITLYYASNHWPNAALCLTLFGGSFIAARLLFGNLINRLGGFRVAIVCMSVESLGLLLLWL
APTPDLALAGAALTGFGFSLVFPALGVEAVNLVPASSRGAAVGAYSLFIDLSLGITGPLA
GAIAAGFGFVSIFLFAALASLTGLALSVYLYKQAQVLRQ