Protein Info for Psyr_3576 in Pseudomonas syringae pv. syringae B728a

Annotation: pterin-4-alpha-carbinolamine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 PF01329: Pterin_4a" amino acids 18 to 110 (93 residues), 101.6 bits, see alignment E=1.1e-33

Best Hits

Swiss-Prot: 100% identical to PHS_PSEU2: Putative pterin-4-alpha-carbinolamine dehydratase (Psyr_3576) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01724, 4a-hydroxytetrahydrobiopterin dehydratase [EC: 4.2.1.96] (inferred from 100% identity to psb:Psyr_3576)

Predicted SEED Role

"Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)" in subsystem Pterin biosynthesis (EC 4.2.1.96)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.96

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQG4 at UniProt or InterPro

Protein Sequence (118 amino acids)

>Psyr_3576 pterin-4-alpha-carbinolamine dehydratase (Pseudomonas syringae pv. syringae B728a)
MTTLNQAHCEACRADAPQVSEAELPELLRQIPDWNIEVRDAVMQLEKVFLFKNFKWALAF
TNAVGEIAEAEGHHPGLLTEWGKVTVTWWSHSIKGLHRNDFIMAARTDEVAKGAEGRK