Protein Info for Psyr_3566 in Pseudomonas syringae pv. syringae B728a

Annotation: transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF00165: HTH_AraC" amino acids 242 to 281 (40 residues), 32.6 bits, see alignment 6.6e-12 amino acids 296 to 330 (35 residues), 26.8 bits, see alignment 4.5e-10 PF12833: HTH_18" amino acids 255 to 333 (79 residues), 83.7 bits, see alignment E=9.1e-28

Best Hits

Swiss-Prot: 82% identical to ARGR_PSEAE: HTH-type transcriptional regulator ArgR (argR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3566)

Predicted SEED Role

"Arginine pathway regulatory protein ArgR, repressor of arg regulon" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQH4 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Psyr_3566 transcriptional regulator, AraC family (Pseudomonas syringae pv. syringae B728a)
MFQIELSSKARLLRQYVSDLPMTAHRIGFLVWPGTRALTLALAEEALRVAQRVHPEVVYE
LSFLQAEAAEPAALAGAWQLPGEPWVGRLEGFQKLFLLADEPPAGVAPALGSALKQLVRA
GCSIGGLSAGVYPLAQLGLLDGYRAAVHWRWQDDFAERFPKVIATSHLFDWDRDRLTACG
GMSVLDLLLAVLSRDHGAELAGAVSEELVVERIREGGERQRIPLQNRLGSSHPKLTQAVL
LMEANIEEPLTTDEIAQHVCVSRRQLERIFKQYLNRVPSQYYLELRLNKARQMLMQTSKS
IIQIGLSCGFSSGPHFSSAYRNFFGATPREDRNQRRSSSPFELSPVPAERG