Protein Info for Psyr_3555 in Pseudomonas syringae pv. syringae B728a

Annotation: aspartate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 TIGR00656: aspartate kinase, monofunctional class" amino acids 1 to 403 (403 residues), 446.7 bits, see alignment E=7.9e-138 PF00696: AA_kinase" amino acids 3 to 229 (227 residues), 182.3 bits, see alignment E=2.6e-57 TIGR00657: aspartate kinase" amino acids 63 to 402 (340 residues), 400.4 bits, see alignment E=1.2e-123 PF01842: ACT" amino acids 267 to 325 (59 residues), 42.4 bits, see alignment E=9.5e-15 PF22468: ACT_9" amino acids 269 to 324 (56 residues), 35 bits, see alignment 1.8e-12 amino acids 343 to 401 (59 residues), 91.3 bits, see alignment E=5.1e-30 PF13840: ACT_7" amino acids 338 to 398 (61 residues), 60.5 bits, see alignment E=2.4e-20

Best Hits

Swiss-Prot: 92% identical to AK_PSEPK: Aspartate kinase (PP_4473) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 100% identity to psp:PSPPH_3511)

MetaCyc: 72% identical to aspartokinase (Halomonas elongata DSM 2581)
Aspartate kinase. [EC: 2.7.2.4]

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQI5 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Psyr_3555 aspartate kinase (Pseudomonas syringae pv. syringae B728a)
MALIVQKFGGTSVGSVERIEQVADKVKKFREAGDDLVVVLSAMSGETNRLIELARQISDQ
PVPRELDVIVSTGEQVTIALLAMALMKRGVPAVSYTGNQVRILTDSAHNKARILQIDDQK
IRSDLKAGRVVVVAGFQGVDEHGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVVSQAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYNVPLRVLHSFKEGPGTLI
TIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANIEVDMIVQNVSH
DNTTDFTFTIHRNDYQAALQVLEATAREISAREVSGDTKIAKVSIVGVGMRSHAGVASRM
FEALAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPRQGE