Protein Info for Psyr_3549 in Pseudomonas syringae pv. syringae B728a

Annotation: MscS Mechanosensitive ion channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 803 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 214 to 234 (21 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 360 to 384 (25 residues), see Phobius details amino acids 404 to 426 (23 residues), see Phobius details amino acids 428 to 432 (5 residues), see Phobius details amino acids 434 to 456 (23 residues), see Phobius details amino acids 487 to 507 (21 residues), see Phobius details amino acids 536 to 557 (22 residues), see Phobius details amino acids 577 to 599 (23 residues), see Phobius details amino acids 608 to 634 (27 residues), see Phobius details PF12607: DUF3772" amino acids 138 to 197 (60 residues), 74.9 bits, see alignment 5.1e-25 PF00924: MS_channel_2nd" amino acids 624 to 689 (66 residues), 77.3 bits, see alignment E=1.2e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3549)

Predicted SEED Role

"potassium efflux system KefA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQJ1 at UniProt or InterPro

Protein Sequence (803 amino acids)

>Psyr_3549 MscS Mechanosensitive ion channel (Pseudomonas syringae pv. syringae B728a)
MQHASLNRFRTGLLALLLLCVTLPALAQNAPAPQADSASSAAPAVEAPSLDDLNQQLDQI
RQKVTVSANDDLLSSLRQAALQVQKQADNLVAQQAVDIEHLNDQLNILGPVQPDEAPSLT
SQRKTLTAQKNALVNDERQTNELSQSARDLATQIFNLRRSLFDSQISTRTASPLSSAFWS
TLIRPTDDDLGRLNRLLVDVRQVLNNAMAPDNRVQFISVVLGALFIWVVVRRLLERLLIW
AMIRWLPEGRLRRSALALAVGLSTILTITIATSLLRWGIVHNAVLSNDVVNLLDQVQTLI
TFCAFIVGLGRALLMLAHASWRLPQIPDQIAIALGRFPPALALALMVIGTQERINSVIAS
SLALTVAVNGLTALAVSLVFFYALLRYRRTRRRFELERPAGFAGLIPFIVAVWVGLSLLA
LLSGYLTLAYFLAVKLLWVSVVASTAYLLIACFGDICETLLSPKQPGGLALGSALGLSTR
HQAQASTVLAGIGRTLLLLTAVLLAFLPSGSSPGDLLASFTQLDVTSKSMGNLNIVPGDI
LVALVCLVVGLLSVRVLKEWFGERLLPETNMDAGMQASLVTLIGYIGFVLVVAVVMSTLN
ISLTNLTWVVSALSVGIGFGLQAIVQNFISGLILLTERPVKVGDWVSLAGVEGDIRRINV
RATEIQMGDRSTVIVPNSQFITQNVRNVTMGNALGVVGITLTLPLETDVLQIRELLLQAF
TEHEAILDAPAPSVTFKDLTNTGLIISASGYVNSPRSVGGARSDLLFTVLGRLRELGVAL
SAPQSMVLINEGAGKEAAAEESQ