Protein Info for Psyr_3540 in Pseudomonas syringae pv. syringae B728a

Annotation: Zinc-containing alcohol dehydrogenase superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08240: ADH_N
  • amino acids 27 to 90 (64 residues), 39.1 bits, E=1.2e-13
• PF01262: AlaDh_PNT_C
  • amino acids 148 to 213 (66 residues), 23.9 bits, E=5e-09
• PF00107: ADH_zinc_N
  • amino acids 156 to 235 (80 residues), 53.2 bits, E=6.2e-18
• PF13602: ADH_zinc_N_2
  • amino acids 187 to 330 (144 residues), 94.5 bits, E=2.3e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3540)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

See Q4ZQK0 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Psyr_3540 Zinc-containing alcohol dehydrogenase superfamily (Pseudomonas syringae pv. syringae B728a)
MKALTFENYGKSPEIAITHVPIPAIKPDELLVEVHAAGLNPIDNMITTGAFKTVVKLQLP
AIMGSDLAGVVIQVGSAVTRFKAGDAVFASLFELGGGAIAEFAAVPEHAAARKPANLDFV
QAASIPMVGLTSWQAFKERASLQSGQKVFIPAGAGGIGTFAIQLAKHLGAEVATTTSTGN
MALVRSLGADEVVNYQEQAFEQLLHDVDLVLGTTRGDDLARAVGILKPGGRIVSLVGPLD
ASFAKARRMNAFFTFVFGLMSRRITRLARKKNVSYSFLFVRADGAQLGEIARLLERGQIT
PVIDRVFAFEQAREGLEYPGQGRAKGKVVVKIK