Protein Info for Psyr_3534 in Pseudomonas syringae pv. syringae B728a

Annotation: Histidine kinase, HAMP region:Cache:Bacterial chemotaxis sensory transducer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details PF02743: dCache_1" amino acids 39 to 260 (222 residues), 109 bits, see alignment E=7.2e-35 PF22673: MCP-like_PDC_1" amino acids 96 to 179 (84 residues), 48.7 bits, see alignment E=2.4e-16 PF00672: HAMP" amino acids 299 to 349 (51 residues), 42.2 bits, see alignment 2.1e-14 PF00015: MCPsignal" amino acids 414 to 594 (181 residues), 143.3 bits, see alignment E=1.7e-45

Best Hits

Swiss-Prot: 63% identical to PCTA_PSEAE: Methyl-accepting chemotaxis protein PctA (pctA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to psb:Psyr_3534)

Predicted SEED Role

"Chemotactic transducer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQK6 at UniProt or InterPro

Protein Sequence (629 amino acids)

>Psyr_3534 Histidine kinase, HAMP region:Cache:Bacterial chemotaxis sensory transducer (Pseudomonas syringae pv. syringae B728a)
MRKSLKFSHKILLAASLVVIAAFTLFTFYNDYLQRNALHVQLKENLNQTSESTAGNIRNW
LSGRILLVENLAENASSPQSPQEQNRVLGQPTLIATFMSIYQGRSDGSFVTQPPDDMSAD
YDPRTRPWYVDALRAGKTILTEPYLDAVTKGLVVTLATPIKGDSGVSGVIGGDLSLEILV
KMISSLRMHGDGYAFLVDANGRILVHPDTSLVMKTLAEVYPANTPRLSQDLSESEYAGKT
QILTFAHVDGLPSVNWYVGVAMDKDIAYAALGEFRNSAIVATVIAVVLIILLLGMLLSVL
LRPLNLMGRAMHDIAAGEGDLTKRLVIESQDEFGHLGNGFNLFVERIHDSMREVASSTVQ
LNEVALRVLNASNSSMLNSDQQSHRTNSVAAAINELGAATQEIAQNAARASGHSSDARTL
ASDGQDVVGQNIEAMSRLSKRISSASGQIETLNTKTANIGQILDVITGISQQTNLLALNA
AIEAARAGEAGRGFAVVADEVRSLAHRTQESASQVQEMIEQLQSGAREAVSIMNDSQRES
VETVGIANKAVASLEHVTERIGEIDGMNQSVAAATEEQTAVVEAINVDITEINTLNQQGV
ENLNATLRACTDLEQQSTRLTQLVGSFRI