Protein Info for Psyr_3531 in Pseudomonas syringae pv. syringae B728a

Annotation: Permease for cytosine/purines, uracil, thiamine, allantoin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 27 to 53 (27 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 261 to 286 (26 residues), see Phobius details amino acids 306 to 329 (24 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 369 to 393 (25 residues), see Phobius details amino acids 419 to 440 (22 residues), see Phobius details amino acids 446 to 465 (20 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 24 to 451 (428 residues), 283.4 bits, see alignment E=1.6e-88

Best Hits

KEGG orthology group: K03457, nucleobase:cation symporter-1, NCS1 family (inferred from 100% identity to psb:Psyr_3531)

Predicted SEED Role

"Hydantoin permease" in subsystem Hydantoin metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQK9 at UniProt or InterPro

Protein Sequence (483 amino acids)

>Psyr_3531 Permease for cytosine/purines, uracil, thiamine, allantoin (Pseudomonas syringae pv. syringae B728a)
MTDQRPAGYSPRLHNHDLGPVPQKWTWYNILAFWMSDVHSVGGYVFAASLFALGLASWQV
LIALLVGICIIQVIANLVAKPSQQAAVPYPVICRLAFGVFGANIPAIIRGLIAVAWYGIQ
TYLASSALVIVVLRFFPELAVYQSVTFLGLSWLGWFGFLALWVVQAAVFWTGMESIRRFI
DWAGPAVYAVMFALAGWIVWRAGWDNISFTLAEKELSGWAAFGQVVMAIALVVSYFSGPT
LNFGDFSRYCRSMADVRRGNFWGLPVNFLAFSLVTVVIVSGTLPIFGEMIHDPIATVARI
DNTTAVLLGAFTFVTATVGINIVANFVSPAFDFANVAPSRISWRAGGMIAAVASIFITPW
NLFNNPEVIHYTLDVLAACIGPLFGILLVDYYLIKKQQIDVDALFDDTPSGRYWYTNGVN
WIAVKALLLTALVGLCFTFVEWFKPIANFAWFTGCILGGAVFYALTRWSPVQAANLPAPV
GQH