Protein Info for Psyr_3512 in Pseudomonas syringae pv. syringae B728a

Annotation: ATP-binding region, ATPase-like:Histidine kinase, HAMP region:Histidine kinase A, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 166 to 188 (23 residues), see Phobius details PF08521: 2CSK_N" amino acids 24 to 161 (138 residues), 32.9 bits, see alignment E=1.6e-11 PF26769: HAMP_PhoQ" amino acids 188 to 232 (45 residues), 30.3 bits, see alignment 8.6e-11 PF00512: HisKA" amino acids 239 to 302 (64 residues), 45.6 bits, see alignment E=1.5e-15 PF02518: HATPase_c" amino acids 349 to 454 (106 residues), 76.1 bits, see alignment E=7.3e-25

Best Hits

KEGG orthology group: K02484, two-component system, OmpR family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to psb:Psyr_3512)

Predicted SEED Role

"Sensory histidine kinase QseC" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQM8 at UniProt or InterPro

Protein Sequence (457 amino acids)

>Psyr_3512 ATP-binding region, ATPase-like:Histidine kinase, HAMP region:Histidine kinase A, N-terminal (Pseudomonas syringae pv. syringae B728a)
MTSVRARILVPVLMLLLLGDLTISLLALRDSHHEIEEVYDAQLAQSARLLQGVLHQRAAG
EQDLDKLYQAFDQAMSRVGTSGVAHPYETRLTFQVWRTSGELLVRSAEAPLLSAPPATEG
SHDLVENGHEWCGFLLADPQQGFLIWVGERDDVRQDLIQRIVSHTLWPTLIGVPLLVVAI
WLAIGWGLRPLQAMARVIRKRDAESLEPLAVTPLPKELEPMQYALNRLLTQIESVLERER
RFIADAAHELRTPLTILRIHAQNARQAETPEQRLEALDFLVHGVDRAARLASQLLTMARL
EPRLEVSQLQTFELNTLVREEMAELTPLALEKRVDLVFEEGEDCVIRSDPAAITIALQNL
LTNALNFAPTASEIRVALHTQEDGSAHLSVEDAGPGIDEQQKARLFERFYSQGHSNGAGL
GLAIVDMIVRKLESSLHLRNSAQGGLCAELRIKSRTS