Protein Info for Psyr_3497 in Pseudomonas syringae pv. syringae B728a

Annotation: SH3-like region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details TIGR04211: SH3 domain protein" amino acids 100 to 275 (176 residues), 146.3 bits, see alignment E=4.5e-47 PF08239: SH3_3" amino acids 107 to 157 (51 residues), 41.7 bits, see alignment 5.3e-15

Best Hits

KEGG orthology group: K07184, SH3 domain protein (inferred from 100% identity to psb:Psyr_3497)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQP3 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Psyr_3497 SH3-like region (Pseudomonas syringae pv. syringae B728a)
MKGIIRCFFNAPDRQTFRPGRSCKTVDHLPLPSLAGPLNEALFSFQIKIIIAMSRHFSAL
LSRAPGLFAVSRRLLGAGLVGAALTVVMPGSAQAAGSDRWVSDSLTTYVRSGPTDDHRIV
GTLKSGQKVELLSASGKFSQVRGEGGSTVWIPSSDLQEVPGQAERVPQLTQQVADLTEQL
AGIDNTWKTRVQGMQETLDARKKLVDELEARTKTLNDQLADSQAELRATQARLGDENKQV
MMRYMVYGGSIAGAGLLVGLILPALTKGRKKNDGWV