Protein Info for Psyr_3493 in Pseudomonas syringae pv. syringae B728a

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF08241: Methyltransf_11" amino acids 52 to 115 (64 residues), 33.9 bits, see alignment E=2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3493)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQP7 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Psyr_3493 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MLLAKKYCQGHGIELGAAAHNAFNLANCLNVAPCNGVDFLHPRDMEDYQQYFVEQMKVSG
DVSKVDMLGDFQCIHTPDSSVDYLISSHVIEHVPNLFSAYVESFRVLKNGGVFFCIFPKR
TAAKTDRARRLTTLTQMIEDYENKVDMTTVTEGEWRGHYQVFSLQSMLRAVNYVNSSGLG
CWYIECVEETDSKVGNGHTVVLRKVEGLSAEKWQDLGDFNTQFNQLLMAGKLENALTLTK
IMLSFNFFDATRLHLAGALSRQLGNVAEGVEFLRQALVVDPENEDYRKEFIEVTGTPFHN
PVL