Protein Info for Psyr_3483 in Pseudomonas syringae pv. syringae B728a

Annotation: Cyanase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 TIGR00673: cyanase" amino acids 1 to 155 (155 residues), 192 bits, see alignment E=2.8e-61 PF21291: CYNS_N" amino acids 11 to 79 (69 residues), 107.5 bits, see alignment E=2.6e-35 PF02560: Cyanate_lyase" amino acids 87 to 153 (67 residues), 111 bits, see alignment E=1.9e-36

Best Hits

Swiss-Prot: 100% identical to CYNS_PSEU2: Cyanate hydratase (cynS) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01725, cyanate lyase [EC: 4.2.1.104] (inferred from 100% identity to psb:Psyr_3483)

MetaCyc: 63% identical to cyanase (Escherichia coli K-12 substr. MG1655)
Cyanase. [EC: 4.2.1.104]

Predicted SEED Role

"Cyanate hydratase (EC 4.2.1.104)" in subsystem Cyanate hydrolysis (EC 4.2.1.104)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.104

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQQ7 at UniProt or InterPro

Protein Sequence (155 amino acids)

>Psyr_3483 Cyanase (Pseudomonas syringae pv. syringae B728a)
MPHSNISRAPRQHLTERVLQAKTAKNLTWAGLAEGTGLSVVYVTAALLGQHPLPQAVAEV
VAERLGLDRDAVAELQTIPLRGNVEDVSSDPTIYRFHEMVQVYGTTLKALVHEQFGDGII
SAINFKLDIKKVDDPEGGERAVITLDGKFLPYKPF