Protein Info for Psyr_3479 in Pseudomonas syringae pv. syringae B728a

Annotation: Flagellar hook capping protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF03963: FlgD" amino acids 14 to 81 (68 residues), 77 bits, see alignment E=1.6e-25 PF13861: FLgD_tudor" amino acids 90 to 225 (136 residues), 58.1 bits, see alignment E=1.2e-19 PF13860: FlgD_ig" amino acids 113 to 182 (70 residues), 71.8 bits, see alignment E=5.6e-24

Best Hits

KEGG orthology group: K02389, flagellar basal-body rod modification protein FlgD (inferred from 100% identity to psb:Psyr_3479)

Predicted SEED Role

"Flagellar basal-body rod modification protein FlgD" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQR1 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Psyr_3479 Flagellar hook capping protein (Pseudomonas syringae pv. syringae B728a)
MAVDSTAANSVSSTFLNTLQNPTPTATNSTGTLGKDSFLQLLVTQMKNQNPLDPQDNTQF
VAQLAQFSSLESMQNLTSTVDTIASSYKSSQALQASSLVGRSVIIDASSTSVDTTKGLTG
SIVVPSESSLTTVKVYDAQSNLVDSVDLGTQKAGTTSFAWDGTDSSGTQLPSGTYSFKAE
GSVEGKNTQFSTYLPATVNSVTLGVNGAETTLNLASGSVALSKVQTIGL