Protein Info for Psyr_3478 in Pseudomonas syringae pv. syringae B728a

Annotation: Flagellar basal body rod protein:Protein of unknown function DUF1078:Flagellar basal body FlaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 TIGR03506: flagellar hook-basal body protein" amino acids 1 to 424 (424 residues), 301.4 bits, see alignment E=6.5e-94 PF00460: Flg_bb_rod" amino acids 4 to 33 (30 residues), 29.7 bits, see alignment (E = 1e-10) PF22692: LlgE_F_G_D1" amino acids 85 to 133 (49 residues), 45.7 bits, see alignment 1.2e-15 PF07559: FlgE_D2" amino acids 163 to 323 (161 residues), 97.4 bits, see alignment E=2.2e-31 PF06429: Flg_bbr_C" amino acids 398 to 441 (44 residues), 48.4 bits, see alignment 1e-16

Best Hits

KEGG orthology group: K02390, flagellar hook protein FlgE (inferred from 100% identity to psb:Psyr_3478)

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQR2 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Psyr_3478 Flagellar basal body rod protein:Protein of unknown function DUF1078:Flagellar basal body FlaE (Pseudomonas syringae pv. syringae B728a)
MSFNIGLSGLYAANKSLDVTGNNIANVATTGFKSSRAEFADQYAQSIRGTSGNTSVGSGV
RTAAVSQQFSQGSLTTGTANSLDLAINGDGFFMMSNNGEKLYTRAGAFHTDKEGYVVNSS
NMKLQGYNVDANGAVVTGALSDLRVNASNLEPKATTTITNSANLNSTTALPTVATFDATD
TNSYNVKYSTPTYDTQGNAHTLDQYFVKTGTNTWSMYSLMDGRSISDPTSTTPDKNNLTF
DSSGKLVTTAGGAVPTDSANIKFNADGTFAVTNWVPGVQVGTGTAATWAANGATGAASIK
LDMSSTTQTASVSGLLKQDQNGYATGQLSGMNVDSSGNLFATYTNGKSQVIGQTSLTSFA
NVQGLAQAGGTNWRETFASGVPVSGAPQSGTLGYITGQALEESNVDLTMELVNLIKAQSN
YQANAKTISTQSTIMQTTIQMT