Protein Info for Psyr_3464 in Pseudomonas syringae pv. syringae B728a

Annotation: Flagellar hook-associated protein 2, N-terminal:Flagellar hook-associated 2, C-terminal:Flagellin hook IN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 PF02465: FliD_N" amino acids 13 to 110 (98 residues), 77 bits, see alignment E=2.1e-25 PF07196: Flagellin_IN" amino acids 131 to 186 (56 residues), 38.5 bits, see alignment 1.6e-13 PF07195: FliD_C" amino acids 226 to 463 (238 residues), 197.8 bits, see alignment E=3e-62

Best Hits

KEGG orthology group: K02407, flagellar hook-associated protein 2 (inferred from 100% identity to psb:Psyr_3464)

Predicted SEED Role

"Flagellar hook-associated protein FliD" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQS6 at UniProt or InterPro

Protein Sequence (483 amino acids)

>Psyr_3464 Flagellar hook-associated protein 2, N-terminal:Flagellar hook-associated 2, C-terminal:Flagellin hook IN (Pseudomonas syringae pv. syringae B728a)
MASPITSTNGIGSGLAIGSIVEGLVGAEKAPKQNQIDKQSASTTASLSGVSQLTSALAAF
QKTLDTLASSTTPAFQGFAATSSNEAVVKATAGNTAVNGSYAINVSQLATPSKVATAALD
STQSSAIPSGTLKITQNGTDYNVAIDKTSTLQEVRDKVNSTLQGKGITANIINDNNGSRL
VFSSTTTGKGSDISVTGASGQEALNIDGTKLMSESSTGAGAITAVAKDAAFTVDGLSLTS
KTNTVSTAISGLTFELVAPSASSAPSASTTVTVATNTDGLKTSLQSFVDSYNTLVSLVSS
LTKGTVDSQGKYTAAALTGDSAPRALLATIRDQIATATSNAGLSSLAQLGIKTQQSDGKL
TLSTTELTTALSDKKLGSQIQAMFTGVTNADGTSSGGLIARMNTALEPYTKADGVLAGKT
TSLNKVQTRLASDQEALNRRITTLTATLTKKYNAMDLVVGQLKATASSITSIFEAMNAQK
NAS