Protein Info for Psyr_3459 in Pseudomonas syringae pv. syringae B728a

Annotation: Helix-turn-helix, Fis-type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 100.3 bits, see alignment E=2.6e-32 PF00158: Sigma54_activat" amino acids 135 to 296 (162 residues), 233.2 bits, see alignment E=4.9e-73 PF14532: Sigma54_activ_2" amino acids 138 to 296 (159 residues), 59.6 bits, see alignment E=1.5e-19 PF07728: AAA_5" amino acids 154 to 272 (119 residues), 25.8 bits, see alignment E=3.4e-09 PF25601: AAA_lid_14" amino acids 302 to 371 (70 residues), 72.3 bits, see alignment E=8.7e-24 PF02954: HTH_8" amino acids 418 to 456 (39 residues), 50.9 bits, see alignment 3.7e-17

Best Hits

KEGG orthology group: K10943, two component system, response regulator FlrC (inferred from 100% identity to psb:Psyr_3459)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQT1 at UniProt or InterPro

Protein Sequence (471 amino acids)

>Psyr_3459 Helix-turn-helix, Fis-type (Pseudomonas syringae pv. syringae B728a)
MPINVLLVEDDRSLREALGETLELAGYDYKAVGSAEEALVAAEATPFSLVISDVNMPGMD
GHQLLSLLRSRHPQLPVLLMTAHGAVERAVDAMRQGAADYLVKPFEPKALIALVARHALG
RLEPAERDGPIAVEPASIQLLNLASRVAKSDSTVLISGESGTGKEVLARFIHQNSPRADK
PFIAINCAAIPDNMLEATLFGHEKGSFTGAIAAQAGKFEQADGGTILLDEISEMPLGLQA
KLLRVLQEREVERVGARKPIVLDIRVVATTNRDLAGEVAAGRFREDLFYRLSVFPLAWQA
LRQRTADILPLAERLLAKHVNKMKHAPVRLSAEAQQCLVSYPWPGNVRELDNAVQRALIL
QQGGVIQAQDFCLSGPVTSLPVAASVEAAVAVTGTTVAENAGAGVSPESVGALGDDLRRH
EFQMIIDTLRSERGRRKEAAERLGISPRTLRYKLAQMRDAGMDVEAYLFAT