Protein Info for Psyr_3458 in Pseudomonas syringae pv. syringae B728a

Annotation: Flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00205: flagellar hook-basal body complex protein FliE
  • amino acids 28 to 110 (83 residues), 85.7 bits, E=1.4e-28
• PF02049: FliE
  • amino acids 30 to 111 (82 residues), 106.6 bits, E=3.1e-35

Best Hits

Swiss-Prot: 99% identical to FLIE_PSESM: Flagellar hook-basal body complex protein FliE (fliE) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 98% identity to psp:PSPPH_3384)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

See Q4ZQT2 at UniProt or InterPro

Protein Sequence (111 amino acids)

>Psyr_3458 Flagellar hook-basal body complex protein FliE (Pseudomonas syringae pv. syringae B728a)
MSMSQGVEFNRLMLDMRAMQMDAMSAPKPVSGAQEAGASSFADMLGQAVNKVAQTQQASS
QLANAFEVGKSGVDLTDVMISSQKASVSFQALTQVRNKLVQAYQDIMQMPV