Protein Info for Psyr_3443 in Pseudomonas syringae pv. syringae B728a

Annotation: Flagellar biosynthesis protein FliQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 89 transmembrane" amino acids 13 to 39 (27 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details PF01313: Bac_export_3" amino acids 6 to 77 (72 residues), 91.6 bits, see alignment E=1.2e-30

Best Hits

Swiss-Prot: 43% identical to FLIQ_BUCAP: Flagellar biosynthetic protein FliQ (fliQ) from Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

KEGG orthology group: K02420, flagellar biosynthetic protein FliQ (inferred from 100% identity to psp:PSPPH_3369)

Predicted SEED Role

"Flagellar biosynthesis protein FliQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQU7 at UniProt or InterPro

Protein Sequence (89 amino acids)

>Psyr_3443 Flagellar biosynthesis protein FliQ (Pseudomonas syringae pv. syringae B728a)
MTPEVAVDLFREALWLTTVLVAILVVPSLLCGLLVAMFQAATQINEQTLSFLPRLLVMLV
TLIVIGPWLLKIFMEYMLSLYTSIPTLIG