Protein Info for Psyr_3432 in Pseudomonas syringae pv. syringae B728a

Annotation: MotA/TolQ/ExbB proton channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details PF20560: MotA_N" amino acids 6 to 64 (59 residues), 34.5 bits, see alignment E=1.9e-12 PF01618: MotA_ExbB" amino acids 102 to 220 (119 residues), 112.1 bits, see alignment E=1.6e-36

Best Hits

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 100% identity to psb:Psyr_3432)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQV8 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Psyr_3432 MotA/TolQ/ExbB proton channel (Pseudomonas syringae pv. syringae B728a)
MDVLSLIGLILAFVAIIGGNFLEGGHLGALLNGPAALIVLGGTLGASLLQSPMSAFMRAM
KIIHWIIFPPRIDLPGGVDRVIGWSMTARKEGLLGLETVADSEPDGYARKGLQLLVDGAE
PAAIRSILEVDFITQETRDIQAAKVFESMGGYAPTVGIIGAVMGLIHVMGNLADPSQLGS
GIAVAFVATIYGVAMANLILLPVANKLKAIAHRQARYREMLLEGLLSIAEGENPRSIELK
LQGFME