Protein Info for Psyr_3428 in Pseudomonas syringae pv. syringae B728a

Annotation: CheW-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF01584: CheW" amino acids 15 to 151 (137 residues), 137.2 bits, see alignment E=1.5e-44

Best Hits

Swiss-Prot: 32% identical to CHEW_SALTY: Chemotaxis protein CheW (cheW) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03408, purine-binding chemotaxis protein CheW (inferred from 99% identity to pst:PSPTO_1988)

Predicted SEED Role

"Positive regulator of CheA protein activity (CheW)" in subsystem Bacterial Chemotaxis or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQW2 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Psyr_3428 CheW-like protein (Pseudomonas syringae pv. syringae B728a)
MNKSSAQGSEDPILQWVTFRLDNESYGINVMQVQEVLRYTEIAPVPGAPSYVLGIINLRG
NVVTVIDTRQRFGLAPVEVSDNTRIVIIEADKQVVGILVDSVAEVVYLRQSEVETAPNVG
NDESAKFIQGVCNKNGELLILVELDKMMSEEEWSELENI