Protein Info for Psyr_3425 in Pseudomonas syringae pv. syringae B728a

Annotation: Cyclic nucleotide-binding:Bacterial regulatory protein, Crp

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF00027: cNMP_binding" amino acids 45 to 127 (83 residues), 62.6 bits, see alignment E=4.1e-21 PF13545: HTH_Crp_2" amino acids 163 to 236 (74 residues), 59.9 bits, see alignment E=2.9e-20 PF00325: Crp" amino acids 188 to 219 (32 residues), 52.6 bits, see alignment 4.4e-18

Best Hits

Swiss-Prot: 90% identical to ANR_PSEPH: Transcriptional activator protein Anr (anr) from Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CHA0)

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 100% identity to psb:Psyr_3425)

Predicted SEED Role

"Fumarate and nitrate reduction regulatory protein" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQW5 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Psyr_3425 Cyclic nucleotide-binding:Bacterial regulatory protein, Crp (Pseudomonas syringae pv. syringae B728a)
MSEPVKLRAQTQAHCKDCSLAPLCLPLSLNTEDMDCLDQIVKRGRPLKKGEFLFRQGDTF
ESVYAVRSGALKTFNISDSGEEQLTGFHLPSELVGMSGMDAEAYPVSAQALETTSVCEIP
FERLDELSVRLPQLRRQLMRVMSREIRDDQQMMLLLSKKTADERIATFLINLSARFRARG
FSANQFRLSMSRNEIGNHLGLAVETVSRVFTRFQQNQLISAEGKEIHILDPIELCALAGG
SMQS