Protein Info for Psyr_3421 in Pseudomonas syringae pv. syringae B728a

Annotation: Copper-translocating P-type ATPase:Heavy metal translocating P-type ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 824 transmembrane" amino acids 183 to 204 (22 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 433 to 454 (22 residues), see Phobius details amino acids 460 to 483 (24 residues), see Phobius details amino acids 758 to 775 (18 residues), see Phobius details amino acids 781 to 801 (21 residues), see Phobius details PF12156: ATPase-cat_bd" amino acids 11 to 94 (84 residues), 98.7 bits, see alignment E=8.1e-32 PF00403: HMA" amino acids 101 to 161 (61 residues), 44.4 bits, see alignment 5.3e-15 TIGR01511: copper-translocating P-type ATPase" amino acids 236 to 801 (566 residues), 455.5 bits, see alignment E=6.1e-140 TIGR01525: heavy metal translocating P-type ATPase" amino acids 253 to 801 (549 residues), 503.3 bits, see alignment E=2.2e-154 TIGR01512: cadmium-translocating P-type ATPase" amino acids 281 to 802 (522 residues), 359.3 bits, see alignment E=6.7e-111 TIGR01494: HAD ATPase, P-type, family IC" amino acids 289 to 782 (494 residues), 220.2 bits, see alignment E=7.7e-69 PF00122: E1-E2_ATPase" amino acids 316 to 416 (101 residues), 86.7 bits, see alignment E=2.5e-28 PF00702: Hydrolase" amino acids 509 to 713 (205 residues), 99.7 bits, see alignment E=8.8e-32 PF12710: HAD" amino acids 631 to 709 (79 residues), 28.5 bits, see alignment E=5.8e-10 PF08282: Hydrolase_3" amino acids 685 to 736 (52 residues), 35.6 bits, see alignment 2.6e-12

Best Hits

KEGG orthology group: K01533, Cu2+-exporting ATPase [EC: 3.6.3.4] (inferred from 100% identity to psb:Psyr_3421)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoI; Copper-translocating P-type ATPase (EC 3.6.3.4)" (EC 3.6.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.4

Use Curated BLAST to search for 3.6.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQW9 at UniProt or InterPro

Protein Sequence (824 amino acids)

>Psyr_3421 Copper-translocating P-type ATPase:Heavy metal translocating P-type ATPase (Pseudomonas syringae pv. syringae B728a)
MARPSSPAPLHCYHCGLPVPAGSHFNAVVLGASRRLCCPGCQAVTEAIVASGLDNYYRHR
SETSANPESLPSQLLDELALYDRPDVQAPFVRHDGDLSEATLLVEGISCAACGWLIEQRL
GRLPGVTEARLNLSTHRLLVRWNADQLALSQLLNELHAIGYVAHPWQADRAAERLASDNR
LALRQLGVAGLLWFQAMMATMATWPEFNIDLSPQMHTILRWVALFLTTPIVFYSCAPFFR
GALRDLRSRHLTMDVSVSLAIGAAYAAGIWTAVTGAGELYVDAVGMFALFLLAGRYLERR
ARERTAAATAQLVNVLPASCLRLNDDGQSQRIMLSELHLADQVLVQPGAVIPADGKILEG
RSSVDESLLTGEYLPQMRSVGDAVTAGTLNVESPLTIGVTALGHETRLSAIVRLLERAQA
EKPRLAQIADRAAQTFLLLSLIAAALIGVIWWQLDASRAVWIVLAMLVATCPCALSLATP
TALTAATGTLHRLGLLLTRGHVLEGLNQIDTVIFDKTGTLTEGRLTLRSIHPLRELDANR
CLELAAALENRSEHPIARVFGRAPRAAEEVLSTPGMGLQGRVDGHLLRIGEAAFVCALSG
AETPLPTERSGQWLLLGDAQGPLAWLVLDDRLREDAGTLLHACRARGWKTLLLSGDSSPM
VGSVAQALGIDDARGGMRPNDKLEVLRQLQAQGRKVLMIGDGVNDVPVMAAADISVAMGS
ATDLAKTSADAVLLCNRLPVLIDALNLARRTRRVIIENLLWAGLYNGLMLPFAALGWITP
VWAAIGMSLSSLTVVLNALRLTRLPRRALARQPAPEVSCPRFTS