Protein Info for Psyr_3419 in Pseudomonas syringae pv. syringae B728a

Annotation: 4Fe-4S ferredoxin, iron-sulfur binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 42 to 60 (19 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 338 to 362 (25 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 39 to 466 (428 residues), 574.1 bits, see alignment E=1e-176 PF13746: Fer4_18" amino acids 217 to 322 (106 residues), 153.6 bits, see alignment E=8.1e-49 PF11614: FixG_C" amino acids 353 to 467 (115 residues), 96.4 bits, see alignment E=4.6e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3419)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQX1 at UniProt or InterPro

Protein Sequence (470 amino acids)

>Psyr_3419 4Fe-4S ferredoxin, iron-sulfur binding protein (Pseudomonas syringae pv. syringae B728a)
MTKQIPVHDITPASETGGEFTDLYASREKIQTRAFKGLFRNVRMLGGALLLLIFFGTVWL
NRSGHQAVWWNLPERKFYIFGATFWPQDFILLSGILIVAAFGLFFITVYAGRVWCGYTCP
QSVWTWIFMWCEKVTEGDRNQRIRLDHASMSAGKLLRKFAKHSLWLLIGFATGMTFVGYF
SPIRALCVDLFTGQADGWAYFWVGFFTLATYLNAGWLREQVCIYMCPYARFQSVMFDKDT
LIISYDQNRGEARGPRKKEADPQALGLGDCIDCTMCVQVCPTGIDIRDGLQVECISCAAC
VDACDTVMDKMDYPRGLIRYTTEHNLSGQRTRTLRPRLIGYALVLLLMIALLTAAFCMRT
LVGLEVSKDRMLFRENAEGRIENVYSLKVMNKDQVDHAYVLQASGLPDLKLQGRRKISVP
AGEIVSLPVELSSAPEKLPSHSNEVTFTLKDIDSDAQVETQSRFLGPPIR