Protein Info for Psyr_3401 in Pseudomonas syringae pv. syringae B728a

Annotation: GCN5-related N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF00583: Acetyltransf_1" amino acids 33 to 100 (68 residues), 37.8 bits, see alignment E=4.1e-13 PF13673: Acetyltransf_10" amino acids 42 to 131 (90 residues), 47.3 bits, see alignment E=4.2e-16 PF13508: Acetyltransf_7" amino acids 46 to 120 (75 residues), 47 bits, see alignment E=5.5e-16 PF18014: Acetyltransf_18" amino acids 159 to 275 (117 residues), 69.4 bits, see alignment E=5e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3401)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQY9 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Psyr_3401 GCN5-related N-acetyltransferase (Pseudomonas syringae pv. syringae B728a)
MPATPDAHYQYRPVTAADIPAAHALSVSLKWPHREQDWAMVQRTSEGFVAEHDGQLVGVA
FTCHQGDWSSIGLVIVRDDHQGKGIGRHLMRLCLDATAPRTPILNATELGAPLYQSLGFV
DFARIQQHQGVADLSGLAPAKDDVPIRTLGATDHAELIRLANAGSGLDRTAVLTDLLHDA
EQAVGIEHAGQLQGIALLRRFGRGHIIGPVVAGDVNQAQRLIEHLLQQIPGLFVRFDILA
DCGLAAWLESLSLPCVDRAPRMVLGTPPAANPDVQQFALVTQAIG